SCOPe 2.07: Domain d5eqra1: 5eqr A:1004-1179

Lineage for d5eqra1 (5eqr A:1004-1179)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Hepatitis C virus [TaxId:11103] [189262] (15 PDB entries)

8. Domain d5eqra1: 5eqr A:1004-1179 [326384]
   Other proteins in same PDB: d5eqra2
   automated match to d5epna_
   complexed with so4, tsv, zn

Details for d5eqra1

PDB Entry: 5eqr, 1.96 Å

PDB Description: crystal structure of a genotype 1a/3a chimeric hcv ns3/4a protease in complex with danoprevir

PDB Compounds: (A:) NS3 protease

SCOPe Domain Sequences for d5eqra1:

Sequence; same for both SEQRES and ATOM records:

>d5eqra1 b.47.1.3 (A:1004-1179) automated matches {Hepatitis C virus [TaxId: 11103]}
tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvyhgagtrt
iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdst
gsllsprplsylkgssggpllcpaghavgifraavstrgvakavqfipveslettm

Timeline for d5eqra1:

• d5eqra1 first appeared in SCOPe 2.06
  
• d5eqra1 appears in the current release, SCOPe 2.08