Lineage for d5jd2b_ (5jd2 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415640Protein automated matches [190191] (2 species)
    not a true protein
  7. 2415735Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)
  8. 2415916Domain d5jd2b_: 5jd2 B: [326296]
    automated match to d4yvbb_
    complexed with byy

Details for d5jd2b_

PDB Entry: 5jd2 (more details), 1.9 Å

PDB Description: sfx structure of corestreptavidin-selenobiotin complex
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d5jd2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jd2b_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

SCOPe Domain Coordinates for d5jd2b_:

Click to download the PDB-style file with coordinates for d5jd2b_.
(The format of our PDB-style files is described here.)

Timeline for d5jd2b_: