SCOPe 2.07: Domain d5l63f_: 5l63 F:

Lineage for d5l63f_ (5l63 F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d5l63f_: 5l63 F: [325986]
   Other proteins in same PDB: d5l63a_, d5l63c_, d5l63d_, d5l63e_, d5l63g_, d5l63i_, d5l63j_, d5l63k_, d5l63l_, d5l63n_, d5l63o_, d5l63q_, d5l63r_, d5l63s_, d5l63u_, d5l63w_, d5l63x_, d5l63y_, d5l63z_
   automated match to d4g4sg_
   complexed with 04c, cl, mes, mg

Details for d5l63f_

PDB Entry: 5l63, 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 17

PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l63f_:

Sequence; same for both SEQRES and ATOM records:

>d5l63f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d5l63f_:

• d5l63f_ first appeared in SCOPe 2.06
  
• d5l63f_ appears in the current release, SCOPe 2.08