SCOPe 2.08: Domain d5lrih2: 5lri H:36-249

Lineage for d5lrih2 (5lri H:36-249)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:272943] [325977] (1 PDB entry)

8. Domain d5lrih2: 5lri H:36-249 [325978]
   Other proteins in same PDB: d5lrih1, d5lril_, d5lrim_
   automated match to d1qovh1
   complexed with bcl, bph, cdl, dd9, fe, lda, spn, u10; mutant

Details for d5lrih2

PDB Entry: 5lri, 2.4 Å

PDB Description: photosynthetic reaction center mutant with glul212 replaced with trp (chain l, el212w)

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d5lrih2:

Sequence; same for both SEQRES and ATOM records:

>d5lrih2 b.41.1.1 (H:36-249) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 272943]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrk

Timeline for d5lrih2:

• d5lrih2 first appeared in SCOPe 2.06
  
• d5lrih2 appears in SCOPe 2.07