Lineage for d1qovh1 (1qov H:36-250)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791427Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2791428Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2791429Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2791430Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2791431Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
    Uniprot P11846
  8. 2791455Domain d1qovh1: 1qov H:36-250 [25464]
    Other proteins in same PDB: d1qovh2, d1qovl_, d1qovm_
    complexed with bcl, bph, cdl, cl, fe2, spn, u10; mutant

Details for d1qovh1

PDB Entry: 1qov (more details), 2.1 Å

PDB Description: photosynthetic reaction center mutant with ala m260 replaced with trp (chain m, a260w)
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1qovh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qovh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOPe Domain Coordinates for d1qovh1:

Click to download the PDB-style file with coordinates for d1qovh1.
(The format of our PDB-style files is described here.)

Timeline for d1qovh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qovh2