![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
![]() | Protein Photosynthetic reaction centre [50348] (4 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:272943] [325977] (1 PDB entry) |
![]() | Domain d5lrih2: 5lri H:36-249 [325978] Other proteins in same PDB: d5lrih1, d5lril_, d5lrim_ automated match to d1qovh1 complexed with bcl, bph, cdl, dd9, fe, lda, spn, u10; mutant |
PDB Entry: 5lri (more details), 2.4 Å
SCOPe Domain Sequences for d5lrih2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lrih2 b.41.1.1 (H:36-249) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 272943]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrk
Timeline for d5lrih2: