Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d5l66v_: 5l66 V: [325884] Other proteins in same PDB: d5l66a_, d5l66c_, d5l66d_, d5l66e_, d5l66g_, d5l66i_, d5l66j_, d5l66k_, d5l66l_, d5l66n_, d5l66o_, d5l66q_, d5l66r_, d5l66s_, d5l66u_, d5l66w_, d5l66x_, d5l66y_, d5l66z_ automated match to d4r17h_ complexed with bo2, cl, mg |
PDB Entry: 5l66 (more details), 2.8 Å
SCOPe Domain Sequences for d5l66v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l66v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5l66v_: