Lineage for d5l69f_ (5l69 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994364Domain d5l69f_: 5l69 F: [325680]
    Other proteins in same PDB: d5l69a_, d5l69c1, d5l69c2, d5l69d_, d5l69e_, d5l69g_, d5l69i_, d5l69j_, d5l69k_, d5l69l_, d5l69n_, d5l69o_, d5l69q1, d5l69q2, d5l69r_, d5l69s_, d5l69u_, d5l69w_, d5l69x_, d5l69y_, d5l69z_
    automated match to d4g4sg_
    complexed with 79p, cl, mes, mg

Details for d5l69f_

PDB Entry: 5l69 (more details), 2.7 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 16
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l69f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l69f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5l69f_:

Click to download the PDB-style file with coordinates for d5l69f_.
(The format of our PDB-style files is described here.)

Timeline for d5l69f_: