Lineage for d5l5og_ (5l5o G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225811Domain d5l5og_: 5l5o G: [325660]
    Other proteins in same PDB: d5l5oa_, d5l5ob_, d5l5oc_, d5l5od_, d5l5oe_, d5l5of_, d5l5oh_, d5l5oi_, d5l5oj_, d5l5om_, d5l5on_, d5l5oo_, d5l5op_, d5l5oq_, d5l5or_, d5l5os_, d5l5ot_, d5l5ov_, d5l5ow_, d5l5ox_
    automated match to d1g0ug_
    complexed with 79p, cl, mes, mg

Details for d5l5og_

PDB Entry: 5l5o (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 16
PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d5l5og_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5og_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d5l5og_:

Click to download the PDB-style file with coordinates for d5l5og_.
(The format of our PDB-style files is described here.)

Timeline for d5l5og_: