| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species) contains an extension to the common fold at the N-terminus |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries) |
| Domain d5l54c_: 5l54 C: [325509] Other proteins in same PDB: d5l54a_, d5l54e_, d5l54h_, d5l54i_, d5l54j_, d5l54k_, d5l54l_, d5l54m_, d5l54n_, d5l54o_, d5l54s_, d5l54v_, d5l54w_, d5l54x_, d5l54y_, d5l54z_ automated match to d1iruf_ complexed with 79p, cl, mes, mg |
PDB Entry: 5l54 (more details), 2.8 Å
SCOPe Domain Sequences for d5l54c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l54c_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d5l54c_: