Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d5l5ye_: 5l5y E: [325352] Other proteins in same PDB: d5l5ya_, d5l5yb_, d5l5yc2, d5l5yf_, d5l5yg_, d5l5yh_, d5l5yi_, d5l5yj_, d5l5yk_, d5l5yl_, d5l5ym_, d5l5yn_, d5l5yo_, d5l5yp_, d5l5yq2, d5l5yt_, d5l5yu_, d5l5yv_, d5l5yw_, d5l5yx_, d5l5yy_, d5l5yz_ automated match to d4g4se_ complexed with 3bv, cl, mes, mg |
PDB Entry: 5l5y (more details), 2.7 Å
SCOPe Domain Sequences for d5l5ye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5ye_ d.153.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
Timeline for d5l5ye_:
View in 3D Domains from other chains: (mouse over for more information) d5l5ya_, d5l5yb_, d5l5yc1, d5l5yc2, d5l5yd_, d5l5yf_, d5l5yg_, d5l5yh_, d5l5yi_, d5l5yj_, d5l5yk_, d5l5yl_, d5l5ym_, d5l5yn_, d5l5yo_, d5l5yp_, d5l5yq1, d5l5yq2, d5l5yr_, d5l5ys_, d5l5yt_, d5l5yu_, d5l5yv_, d5l5yw_, d5l5yx_, d5l5yy_, d5l5yz_ |