Lineage for d5l5yq1 (5l5y Q:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996171Domain d5l5yq1: 5l5y Q:1-234 [325337]
    Other proteins in same PDB: d5l5ya_, d5l5yb_, d5l5yc2, d5l5yf_, d5l5yg_, d5l5yh_, d5l5yi_, d5l5yj_, d5l5yk_, d5l5yl_, d5l5ym_, d5l5yn_, d5l5yo_, d5l5yp_, d5l5yq2, d5l5yt_, d5l5yu_, d5l5yv_, d5l5yw_, d5l5yx_, d5l5yy_, d5l5yz_
    automated match to d1iruf_
    complexed with 3bv, cl, mes, mg

Details for d5l5yq1

PDB Entry: 5l5y (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with carfilzomib
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l5yq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5yq1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d5l5yq1:

Click to download the PDB-style file with coordinates for d5l5yq1.
(The format of our PDB-style files is described here.)

Timeline for d5l5yq1: