Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries) |
Domain d5l5vc_: 5l5v C: [325326] Other proteins in same PDB: d5l5va_, d5l5vb_, d5l5vf_, d5l5vg_, d5l5vh_, d5l5vi_, d5l5vj_, d5l5vk_, d5l5vl_, d5l5vm_, d5l5vn_, d5l5vo_, d5l5vp_, d5l5vt_, d5l5vu_, d5l5vv_, d5l5vw_, d5l5vx_, d5l5vy_, d5l5vz_ automated match to d1iruf_ complexed with 6nv, cl, mg |
PDB Entry: 5l5v (more details), 2.7 Å
SCOPe Domain Sequences for d5l5vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5vc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d5l5vc_: