Lineage for d5l5vr_ (5l5v R:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230818Domain d5l5vr_: 5l5v R: [325112]
    Other proteins in same PDB: d5l5va_, d5l5vb_, d5l5vf_, d5l5vg_, d5l5vh_, d5l5vi_, d5l5vj_, d5l5vk_, d5l5vl_, d5l5vm_, d5l5vn_, d5l5vo_, d5l5vp_, d5l5vt_, d5l5vu_, d5l5vv_, d5l5vw_, d5l5vx_, d5l5vy_, d5l5vz_
    automated match to d1iruf_
    complexed with 6nv, cl, mg

Details for d5l5vr_

PDB Entry: 5l5v (more details), 2.7 Å

PDB Description: 'yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with epoxyketone inhibitor 18
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5l5vr_:

Sequence, based on SEQRES records: (download)

>d5l5vr_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5l5vr_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5l5vr_:

Click to download the PDB-style file with coordinates for d5l5vr_.
(The format of our PDB-style files is described here.)

Timeline for d5l5vr_: