Lineage for d5l5es_ (5l5e S:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229814Domain d5l5es_: 5l5e S: [325318]
    Other proteins in same PDB: d5l5ea_, d5l5eb_, d5l5ec_, d5l5ed_, d5l5ef_, d5l5eg_, d5l5ei_, d5l5ej_, d5l5ek_, d5l5el_, d5l5en_, d5l5eo_, d5l5ep_, d5l5eq_, d5l5er_, d5l5et_, d5l5eu_, d5l5ew_, d5l5ex_, d5l5ey_, d5l5ez_
    automated match to d4g4se_
    complexed with 3bv, cl, mes, mg

Details for d5l5es_

PDB Entry: 5l5e (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with carfilzomib
PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l5es_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5es_ d.153.1.4 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5l5es_:

Click to download the PDB-style file with coordinates for d5l5es_.
(The format of our PDB-style files is described here.)

Timeline for d5l5es_: