SCOPe 2.07: Domain d5l5ym_: 5l5y M:

Lineage for d5l5ym_ (5l5y M:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d5l5ym_: 5l5y M: [325209]
   Other proteins in same PDB: d5l5ya_, d5l5yc_, d5l5yd_, d5l5ye_, d5l5yg_, d5l5yi_, d5l5yj_, d5l5yk_, d5l5yl_, d5l5yn_, d5l5yo_, d5l5yq_, d5l5yr_, d5l5ys_, d5l5yu_, d5l5yw_, d5l5yx_, d5l5yy_, d5l5yz_
   automated match to d4qz7m_
   complexed with 3bv, cl, mes, mg

Details for d5l5ym_

PDB Entry: 5l5y, 2.7 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with carfilzomib

PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5l5ym_:

Sequence; same for both SEQRES and ATOM records:

>d5l5ym_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

Timeline for d5l5ym_:

• d5l5ym_ first appeared in SCOPe 2.06
  
• d5l5ym_ appears in the current release, SCOPe 2.08