Lineage for d1c9ja_ (1c9j A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1166768Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1166769Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1166770Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1166838Protein Subtilisin [52745] (6 species)
  7. 1166894Species Bacillus lentus [TaxId:1467] [52750] (9 PDB entries)
  8. 1166901Domain d1c9ja_: 1c9j A: [32507]
    complexed with ca, so4

Details for d1c9ja_

PDB Entry: 1c9j (more details), 1.8 Å

PDB Description: bacillus lentus subtilisin k27r/n87s/v104y/n123s/t274a variant
PDB Compounds: (A:) serine protease

SCOPe Domain Sequences for d1c9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ja_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvrvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsyssiaqglewagnngmhva
slslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaaar

SCOPe Domain Coordinates for d1c9ja_:

Click to download the PDB-style file with coordinates for d1c9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1c9ja_: