Lineage for d1c9ja_ (1c9j A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23787Fold c.41: Subtilisin-like [52742] (1 superfamily)
  4. 23788Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 23789Family c.41.1.1: Subtilases [52744] (7 proteins)
  6. 23809Protein Subtilisin [52745] (6 species)
  7. 23841Species Bacillus lentus [TaxId:1467] [52750] (7 PDB entries)
  8. 23847Domain d1c9ja_: 1c9j A: [32507]

Details for d1c9ja_

PDB Entry: 1c9j (more details), 1.8 Å

PDB Description: bacillus lentus subtilisin k27r/n87s/v104y/n123s/t274a variant

SCOP Domain Sequences for d1c9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ja_ c.41.1.1 (A:) Subtilisin {Bacillus lentus}
aqsvpwgisrvqapaahnrgltgsgvrvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsyssiaqglewagnngmhva
slslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaaar

SCOP Domain Coordinates for d1c9ja_:

Click to download the PDB-style file with coordinates for d1c9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1c9ja_: