SCOPe 2.08: Domain d5lvqa_: 5lvq A:

Lineage for d5lvqa_ (5lvq A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)

8. Domain d5lvqa_: 5lvq A: [324532]
   automated match to d1b91a_
   complexed with 2lx, dms, edo

Details for d5lvqa_

PDB Entry: 5lvq, 2.05 Å

PDB Description: crystal structure of human pcaf bromodomain in complex with compound-d (cpd-d), n-methyl-2-(tetrahydro-2h-pyran-4-yloxy)benzamide

PDB Compounds: (A:) Histone acetyltransferase KAT2B

SCOPe Domain Sequences for d5lvqa_:

Sequence; same for both SEQRES and ATOM records:

>d5lvqa_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyv
skklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid

Timeline for d5lvqa_:

• d5lvqa_ first appeared in SCOPe 2.06
  
• d5lvqa_ appears in SCOPe 2.07