SCOPe 2.06: Domain d4zfid_: 4zfi D:

Lineage for d4zfid_ (4zfi D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (59 PDB entries)

8. Domain d4zfid_: 4zfi D: [324321]
   automated match to d5hmia_
   complexed with 4nj

Details for d4zfid_

PDB Entry: 4zfi, 2 Å

PDB Description: structure of mdm2 with low molecular weight inhibitor

PDB Compounds: (D:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4zfid_:

Sequence; same for both SEQRES and ATOM records:

>d4zfid_ a.42.1.1 (D:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycs
ndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

Timeline for d4zfid_:

• d4zfid_ is new in SCOPe 2.06-stable
  
• d4zfid_ appears in SCOPe 2.07
  
• d4zfid_ appears in the current release, SCOPe 2.08