Lineage for d1g6oa_ (1g6o A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180169Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)
  6. 180213Protein Hexameric traffic ATPase, HP0525 [52719] (1 species)
  7. 180214Species Helicobacter pylori [TaxId:210] [52720] (1 PDB entry)
  8. 180215Domain d1g6oa_: 1g6o A: [32430]

Details for d1g6oa_

PDB Entry: 1g6o (more details), 2.5 Å

PDB Description: crystal structure of the helicobacter pylori atpase, hp0525, in complex with adp
PDB Compounds: (A:)

SCOP Domain Sequences for d1g6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6oa_ c.37.1.13 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori}
lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
fkdlidmivhinhhkqcdefyik

SCOP Domain Coordinates for d1g6oa_:

Click to download the PDB-style file with coordinates for d1g6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1g6oa_: