PDB entry 1g6o

View 1g6o on RCSB PDB site
Description:
Deposited on 2000-11-07, released 2001-01-24
The last revision prior to the SCOP 1.61 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1g6oa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1g6ob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6oA (A:)
    lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
    qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
    etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
    tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
    lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
    fkdlidmivhinhhkqcdefyik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6oB (B:)
    lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
    qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
    etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
    tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
    lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
    fkdlidmivhinhhkqcdefyik