Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Holliday junction helicase RuvB [52713] (2 species) contains "winged helix" DNA-binding domain after the family specific domains |
Species Thermus thermophilus [TaxId:274] [52714] (3 PDB entries) |
Domain d1hqca2: 1hqc A:5-242 [32424] Other proteins in same PDB: d1hqca1, d1hqcb1 complexed with ade, mg |
PDB Entry: 1hqc (more details), 3.2 Å
SCOPe Domain Sequences for d1hqca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqca2 c.37.1.20 (A:5-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} alrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelgv nlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivig qgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarll gvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde
Timeline for d1hqca2: