SCOP 1.55: Domain d1hqca2: 1hqc A:5-242

Lineage for d1hqca2 (1hqc A:5-242)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families)

5. Family c.37.1.13: Extended AAA-ATPase domain [52700] (10 proteins)

6. Protein Holliday junction helicase RuvB [52713] (1 species)

7. Species Thermus thermophilus [TaxId:274] [52714] (1 PDB entry)

8. Domain d1hqca2: 1hqc A:5-242 [32424]
   Other proteins in same PDB: d1hqca1, d1hqcb1

Details for d1hqca2

PDB Entry: 1hqc, 3.2 Å

PDB Description: structure of ruvb from thermus thermophilus hb8

SCOP Domain Sequences for d1hqca2:

Sequence; same for both SEQRES and ATOM records:

>d1hqca2 c.37.1.13 (A:5-242) Holliday junction helicase RuvB {Thermus thermophilus}
alrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelgv
nlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivig
qgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarll
gvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde

Timeline for d1hqca2:

• d1hqca2 appears in SCOP 1.57
  
• d1hqca2 appears in the current release, SCOPe 2.08