Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species) contains additional alpha-helical domain after the family specific domains |
Species Escherichia coli [TaxId:562] [52712] (6 PDB entries) Uniprot P28631 |
Domain d1a5ta2: 1a5t A:1-207 [32423] Other proteins in same PDB: d1a5ta1 protein/DNA complex; complexed with zn |
PDB Entry: 1a5t (more details), 2.2 Å
SCOPe Domain Sequences for d1a5ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev tmsqdallaalrlsagspgaalalfqg
Timeline for d1a5ta2: