SCOPe 2.01: Domain d1a5ta2: 1a5t A:1-207

Lineage for d1a5ta2 (1a5t A:1-207)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
   contains additional alpha-helical domain after the family specific domains

7. Species Escherichia coli [TaxId:562] [52712] (6 PDB entries)
   Uniprot P28631

8. Domain d1a5ta2: 1a5t A:1-207 [32423]
   Other proteins in same PDB: d1a5ta1
   protein/DNA complex; complexed with zn

Details for d1a5ta2

PDB Entry: 1a5t, 2.2 Å

PDB Description: crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli dna polymerase iii

PDB Compounds: (A:) delta prime

SCOPe Domain Sequences for d1a5ta2:

Sequence; same for both SEQRES and ATOM records:

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg

Timeline for d1a5ta2:

• d1a5ta2 first appeared (with stable ids) in SCOP 1.55, called d1a5t_2
  
• d1a5ta2 appears in SCOP 1.75
  
• d1a5ta2 appears in SCOPe 2.02
  
• d1a5ta2 appears in the current release, SCOPe 2.08