SCOP 1.63: Domain d1d2ma2: 1d2m A:410-583

Lineage for d1d2ma2 (1d2m A:410-583)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (6 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
   contains large insertions in the first AAA domain

7. Species Thermus thermophilus [TaxId:274] [52709] (2 PDB entries)

8. Domain d1d2ma2: 1d2m A:410-583 [32418]
   complexed with bog, so4

Details for d1d2ma2

PDB Entry: 1d2m, 1.9 Å

PDB Description: uvrb protein of thermus thermophilus hb8; a nucleotide excision repair enzyme

SCOP Domain Sequences for d1d2ma2:

Sequence; same for both SEQRES and ATOM records:

>d1d2ma2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus}
tglldplvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirary
lhheldafkrqalirdlrlghydclvginllregldipevslvaildadkegflrsersl
iqtigraarnargevwlyadrvseamqraieetnrrralqeaynlehgitpetv

Timeline for d1d2ma2:

• d1d2ma2 first appeared (with stable ids) in SCOP 1.55
  
• d1d2ma2 appears in SCOP 1.61
  
• d1d2ma2 appears in SCOP 1.65
  
• d1d2ma2 appears in the current release, SCOPe 2.08