Lineage for d1d2ma2 (1d2m A:410-583)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. Protein Nucleotide excision repair enzyme UvrB, C-terminal domain [418969] (2 species)
  7. Species Thermus thermophilus [TaxId:274] [419433] (2 PDB entries)
  8. 2870771Domain d1d2ma2: 1d2m A:410-583 [32418]
    Other proteins in same PDB: d1d2ma1
    complexed with bog, so4

Details for d1d2ma2

PDB Entry: 1d2m (more details), 1.9 Å

PDB Description: uvrb protein of thermus thermophilus hb8; a nucleotide excision repair enzyme
PDB Compounds: (A:) excinuclease abc subunit b

SCOPe Domain Sequences for d1d2ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ma2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tglldplvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirary
lhheldafkrqalirdlrlghydclvginllregldipevslvaildadkegflrsersl
iqtigraarnargevwlyadrvseamqraieetnrrralqeaynlehgitpetv

SCOPe Domain Coordinates for d1d2ma2:

Click to download the PDB-style file with coordinates for d1d2ma2.
(The format of our PDB-style files is described here.)

Timeline for d1d2ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d2ma1