SCOPe 2.07: Domain d1c4oa2: 1c4o A:410-583

Lineage for d1c4oa2 (1c4o A:410-583)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
   contains large insertions in the first AAA domain

7. Species Thermus thermophilus [TaxId:274] [52709] (2 PDB entries)

8. Domain d1c4oa2: 1c4o A:410-583 [32416]
   complexed with bog, so4

Details for d1c4oa2

PDB Entry: 1c4o, 1.5 Å

PDB Description: crystal structure of the dna nucleotide excision repair enzyme uvrb from thermus thermophilus

PDB Compounds: (A:) DNA nucleotide excision repair enzyme uvrb

SCOPe Domain Sequences for d1c4oa2:

Sequence; same for both SEQRES and ATOM records:

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}
tglldplvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirary
lhheldafkrqalirdlrlghydclvginllregldipevslvaildadkegflrsersl
iqtigraarnargevwlyadrvseamqraieetnrrralqeaynlehgitpetv

Timeline for d1c4oa2:

• d1c4oa2 first appeared (with stable ids) in SCOP 1.55
  
• d1c4oa2 appears in SCOPe 2.06
  
• d1c4oa2 appears in the current release, SCOPe 2.08