Lineage for d1c4oa2 (1c4o A:410-583)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. Protein Nucleotide excision repair enzyme UvrB, C-terminal domain [418969] (2 species)
  7. Species Thermus thermophilus [TaxId:274] [419433] (2 PDB entries)
  8. 2870770Domain d1c4oa2: 1c4o A:410-583 [32416]
    Other proteins in same PDB: d1c4oa1
    complexed with bog, so4

Details for d1c4oa2

PDB Entry: 1c4o (more details), 1.5 Å

PDB Description: crystal structure of the dna nucleotide excision repair enzyme uvrb from thermus thermophilus
PDB Compounds: (A:) DNA nucleotide excision repair enzyme uvrb

SCOPe Domain Sequences for d1c4oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tglldplvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirary
lhheldafkrqalirdlrlghydclvginllregldipevslvaildadkegflrsersl
iqtigraarnargevwlyadrvseamqraieetnrrralqeaynlehgitpetv

SCOPe Domain Coordinates for d1c4oa2:

Click to download the PDB-style file with coordinates for d1c4oa2.
(The format of our PDB-style files is described here.)

Timeline for d1c4oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c4oa1