Lineage for d5thkd_ (5thk D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846323Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries)
  8. 2846333Domain d5thkd_: 5thk D: [324078]
    Other proteins in same PDB: d5thkb2, d5thkg2
    automated match to d4rf5a_
    complexed with 1pe, mg, nap

Details for d5thkd_

PDB Entry: 5thk (more details), 1.4 Å

PDB Description: crystal structure of a putative dehydrogenase from burkholderia cenocepacia with bound nadp
PDB Compounds: (D:) Putative Dehydrogenase

SCOPe Domain Sequences for d5thkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thkd_ c.2.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
athtladkvvliaggaknlggliardlaghgakavaihynsaasqaqaeetaaavraaga
eaatfqadlttaaaveklfddakqrfgkidiaintvgkvlkkpfteiseaeydemfavns
ksafffikeagrhledhgklvtlvtsllgaftpfyaayegskapvehftraaskeygarg
isvtavgpgpmdtpffypaegadavayhktaaalspfsktgltdiedvvpfirhlvtdgw
witgqtilinggyttk

SCOPe Domain Coordinates for d5thkd_:

Click to download the PDB-style file with coordinates for d5thkd_.
(The format of our PDB-style files is described here.)

Timeline for d5thkd_: