Lineage for d4rf5a_ (4rf5 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. Protein automated matches [190069] (313 species)
    not a true protein
  7. Species Lactobacillus kefiri [TaxId:33962] [277547] (6 PDB entries)
  8. Domain d4rf5a_: 4rf5 A: [277548]
    automated match to d2rhcb_
    complexed with gol, mg; mutant

Details for d4rf5a_

PDB Entry: 4rf5 (more details), 1.6 Å

PDB Description: crystal structure of ketoreductase from lactobacillus kefir, e145s mutant
PDB Compounds: (A:) NADPH dependent R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d4rf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rf5a_ c.2.1.0 (A:) automated matches {Lactobacillus kefiri [TaxId: 33962]}
tdrlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvq
hdasdeagwtklfdtteeafgpvttvvnnagiavsksvedttteewrkllsvnldgvffg
trlgiqrmknkglgasiinmssisgfvgdptlgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatga
efvvdggytaq

SCOPe Domain Coordinates for d4rf5a_ are not available.

Timeline for d4rf5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4rf5b_