SCOPe 2.07: Domain d5syod_: 5syo D:

Lineage for d5syod_ (5syo D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5syod_: 5syo D: [324048]
   Other proteins in same PDB: d5syoa2, d5syoe2
   automated match to d2w8gc_
   complexed with c5e

Details for d5syod_

PDB Entry: 5syo, 2 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with cytisine

PDB Compounds: (D:) soluble acetylcholine receptor, neuronal acetylcholine receptor subunit alpha-3 chimera

SCOPe Domain Sequences for d5syod_:

Sequence, based on SEQRES records:

>d5syod_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
ykhdikyncceeiypdvvlvvkfre

Sequence, based on observed residues (ATOM records):

>d5syod_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnsl
mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf
mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhd
ikyncceeiypdvvlvvkfre

Timeline for d5syod_:

• d5syod_ first appeared in SCOPe 2.06
  
• d5syod_ appears in the current release, SCOPe 2.08