![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
![]() | Protein automated matches [190292] (37 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323630] (11 PDB entries) |
![]() | Domain d5k2zd_: 5k2z D: [323721] automated match to d3fema_ complexed with 6r3, cl, edo, so4 |
PDB Entry: 5k2z (more details), 1.8 Å
SCOPe Domain Sequences for d5k2zd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k2zd_ c.1.2.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kspfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsd pqmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfri pfvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevf tfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgd parraraivqavthysdpemlvevscglgeamvginln
Timeline for d5k2zd_: