Lineage for d5k2zd_ (5k2z D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2436130Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2436131Protein automated matches [190292] (37 species)
    not a true protein
  7. 2436401Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323630] (11 PDB entries)
  8. 2436413Domain d5k2zd_: 5k2z D: [323721]
    automated match to d3fema_
    complexed with 6r3, cl, edo, so4

Details for d5k2zd_

PDB Entry: 5k2z (more details), 1.8 Å

PDB Description: pdx1.3-adduct (arabidopsis)
PDB Compounds: (D:) Pyridoxal 5'-phosphate synthase subunit PDX1.3

SCOPe Domain Sequences for d5k2zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k2zd_ c.1.2.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kspfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsd
pqmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfri
pfvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevf
tfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgd
parraraivqavthysdpemlvevscglgeamvginln

SCOPe Domain Coordinates for d5k2zd_:

Click to download the PDB-style file with coordinates for d5k2zd_.
(The format of our PDB-style files is described here.)

Timeline for d5k2zd_: