| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
| Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species) |
| Species Thermococcus litoralis [TaxId:2265] [52690] (1 PDB entry) |
| Domain d1g2922: 1g29 2:1-240 [32372] Other proteins in same PDB: d1g2913, d1g2914, d1g2923, d1g2924 CASP4 complexed with cl, dio, mg, na, nh4, pop |
PDB Entry: 1g29 (more details), 1.9 Å
SCOPe Domain Sequences for d1g2922:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2922 c.37.1.12 (2:1-240) Maltose transport protein MalK, N-terminal domain {Thermococcus litoralis [TaxId: 2265]}
magvrlvdvwkvfgevtavremslevkdgefmillgpsgcgktttlrmiagleepsrgqi
yigdklvadpekgifvppkdrdiamvfqsyalyphmtvydniafplklrkvprqeidqrv
revaellgltellnrkprelsggqrqrvalgraivrkpqvflmdeplsnldaklrvrmra
elkklqrqlgvttiyvthdqveamtmgdriavmnrgvlqqvgspdevydkpantfvagfi
Timeline for d1g2922: