Lineage for d1g2922 (1g29 2:1-240)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23620Family c.37.1.12: ABC transporter ATPase domain-like [52686] (6 proteins)
  6. 23638Protein Maltose transport protein MalK, N-terminal domain [52689] (1 species)
  7. 23639Species Archaea (Thermococcus litoralis) [TaxId:2265] [52690] (1 PDB entry)
  8. 23641Domain d1g2922: 1g29 2:1-240 [32372]
    Other proteins in same PDB: d1g2911, d1g2921

Details for d1g2922

PDB Entry: 1g29 (more details), 1.9 Å

PDB Description: malk

SCOP Domain Sequences for d1g2922:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2922 c.37.1.12 (2:1-240) Maltose transport protein MalK, N-terminal domain {Archaea (Thermococcus litoralis)}
magvrlvdvwkvfgevtavremslevkdgefmillgpsgcgktttlrmiagleepsrgqi
yigdklvadpekgifvppkdrdiamvfqsyalyphmtvydniafplklrkvprqeidqrv
revaellgltellnrkprelsggqrqrvalgraivrkpqvflmdeplsnldaklrvrmra
elkklqrqlgvttiyvthdqveamtmgdriavmnrgvlqqvgspdevydkpantfvagfi

SCOP Domain Coordinates for d1g2922:

Click to download the PDB-style file with coordinates for d1g2922.
(The format of our PDB-style files is described here.)

Timeline for d1g2922:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g2921