Lineage for d1g2914 (1g29 1:302-372)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1790106Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 1790190Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 1790210Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 1790250Species Thermococcus litoralis [TaxId:2265] [50340] (1 PDB entry)
  8. 1790252Domain d1g2914: 1g29 1:302-372 [58982]
    Other proteins in same PDB: d1g2912, d1g2922
    CASP4
    complexed with cl, dio, mg, na, nh4, pop

Details for d1g2914

PDB Entry: 1g29 (more details), 1.9 Å

PDB Description: malk
PDB Compounds: (1:) maltose transport protein malk

SCOPe Domain Sequences for d1g2914:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2914 b.40.6.3 (1:302-372) Maltose transport protein MalK, C-terminal domain {Thermococcus litoralis [TaxId: 2265]}
vrvpgenlvravveivenlgserivrlrvggvtfvgsfrsesrvregvevdvvfdmkkih
ifdkttgkaif

SCOPe Domain Coordinates for d1g2914:

Click to download the PDB-style file with coordinates for d1g2914.
(The format of our PDB-style files is described here.)

Timeline for d1g2914: