Class a: All alpha proteins [46456] (289 folds) |
Fold a.242: Dcp2 domain-like [140585] (1 superfamily) 4 helices; orthogonal array of two alpha hairpins |
Superfamily a.242.1: Dcp2 domain-like [140586] (2 families) automatically mapped to Pfam PF05026 |
Family a.242.1.0: automated matches [323645] (1 protein) not a true family |
Protein automated matches [323646] (1 species) not a true protein |
Species Schizosaccharomyces pombe [TaxId:284812] [323647] (2 PDB entries) |
Domain d5kq4e1: 5kq4 E:1-94 [323673] Other proteins in same PDB: d5kq4b2, d5kq4b3, d5kq4e2, d5kq4e3 automated match to d2a6ta1 protein/RNA complex; complexed with 6vq |
PDB Entry: 5kq4 (more details), 2.56 Å
SCOPe Domain Sequences for d5kq4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kq4e1 a.242.1.0 (E:1-94) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg lrvfsaklfahcpllwkwskvheeafddflrykt
Timeline for d5kq4e1: