SCOPe 2.06: Domain d5kq4b2: 5kq4 B:95-239

Lineage for d5kq4b2 (5kq4 B:95-239)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.7: mRNA decapping enzyme-like [143777] (2 proteins)
   part of Pfam PF00293

6. Protein automated matches [231207] (2 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [323649] (2 PDB entries)

8. Domain d5kq4b2: 5kq4 B:95-239 [323650]
   Other proteins in same PDB: d5kq4b1, d5kq4b3, d5kq4e1, d5kq4e3
   automated match to d2a6ta2
   protein/RNA complex; complexed with 6vq

Details for d5kq4b2

PDB Entry: 5kq4, 2.56 Å

PDB Description: crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2 and synthetic cap analog

PDB Compounds: (B:) mRNA decapping complex subunit 2

SCOPe Domain Sequences for d5kq4b2:

Sequence; same for both SEQRES and ATOM records:

>d5kq4b2 d.113.1.7 (B:95-239) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
ripvrgaimldmsmqqcvlvkgwkassgwgfpkgkidkdesdvdcairevyeetgfdcss
rinpnefidmtirgqnvrlyiipgisldtrfesrtrkeiskiewhnlmdlptfkknkpqt
mknkfymvipflaplkkwikkrnia

Timeline for d5kq4b2:

• d5kq4b2 is new in SCOPe 2.06-stable
  
• d5kq4b2 appears in SCOPe 2.07
  
• d5kq4b2 appears in the current release, SCOPe 2.08