Lineage for d5j28b_ (5j28 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604064Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2604212Protein automated matches [190344] (6 species)
    not a true protein
  7. 2604218Species Human (Homo sapiens) [TaxId:9606] [187171] (11 PDB entries)
  8. 2604230Domain d5j28b_: 5j28 B: [323585]
    automated match to d3c5wc_
    complexed with mli, na

Details for d5j28b_

PDB Entry: 5j28 (more details), 2 Å

PDB Description: ki67-pp1g (protein phosphatase 1, gamma isoform) holoenzyme complex
PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

SCOPe Domain Sequences for d5j28b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j28b_ d.159.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d5j28b_:

Click to download the PDB-style file with coordinates for d5j28b_.
(The format of our PDB-style files is described here.)

Timeline for d5j28b_: