Lineage for d5ekia_ (5eki A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536142Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2536143Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2536552Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2536553Protein automated matches [190775] (3 species)
    not a true protein
  7. 2536554Species Human (Homo sapiens) [TaxId:9606] [188003] (13 PDB entries)
  8. 2536562Domain d5ekia_: 5eki A: [323584]
    automated match to d2mp1a_
    complexed with so4

Details for d5ekia_

PDB Entry: 5eki (more details), 1.9 Å

PDB Description: crystal structure of truncated ccl21
PDB Compounds: (A:) C-C motif chemokine 21

SCOPe Domain Sequences for d5ekia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ekia_ d.9.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdcclkysqrkipakvvrsyrkqepslgcsipailflprkrsqaelcadpkelwvqqlmq
hldktpspqkpa

SCOPe Domain Coordinates for d5ekia_:

Click to download the PDB-style file with coordinates for d5ekia_.
(The format of our PDB-style files is described here.)

Timeline for d5ekia_: