Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.0: automated matches [191483] (1 protein) not a true family |
Protein automated matches [190775] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188003] (13 PDB entries) |
Domain d5ekia_: 5eki A: [323584] automated match to d2mp1a_ complexed with so4 |
PDB Entry: 5eki (more details), 1.9 Å
SCOPe Domain Sequences for d5ekia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ekia_ d.9.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qdcclkysqrkipakvvrsyrkqepslgcsipailflprkrsqaelcadpkelwvqqlmq hldktpspqkpa
Timeline for d5ekia_: