Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:242231] [323456] (2 PDB entries) |
Domain d5t8sb3: 5t8s B:237-389 [323467] automated match to d1mxaa3 complexed with 3po, amp, mg, po4, pop, sam |
PDB Entry: 5t8s (more details), 1.7 Å
SCOPe Domain Sequences for d5t8sb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t8sb3 d.130.1.0 (B:237-389) automated matches {Neisseria gonorrhoeae [TaxId: 242231]} iggpqgdcgltgrkiivdtyggaaphgggafsgkdpskvdrsaayacryvaknivaagla tqcqiqvsyaigvaeptsisidtfgtgkiseeklialvcehfdlrpkgivqmldllrpiy gksaayghfgreepeftwertdkaaslkaaagl
Timeline for d5t8sb3: