Lineage for d5t8sb3 (5t8s B:237-389)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976679Species Neisseria gonorrhoeae [TaxId:242231] [323456] (2 PDB entries)
  8. 2976685Domain d5t8sb3: 5t8s B:237-389 [323467]
    automated match to d1mxaa3
    complexed with 3po, amp, mg, po4, pop, sam

Details for d5t8sb3

PDB Entry: 5t8s (more details), 1.7 Å

PDB Description: crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium
PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d5t8sb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t8sb3 d.130.1.0 (B:237-389) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
iggpqgdcgltgrkiivdtyggaaphgggafsgkdpskvdrsaayacryvaknivaagla
tqcqiqvsyaigvaeptsisidtfgtgkiseeklialvcehfdlrpkgivqmldllrpiy
gksaayghfgreepeftwertdkaaslkaaagl

SCOPe Domain Coordinates for d5t8sb3:

Click to download the PDB-style file with coordinates for d5t8sb3.
(The format of our PDB-style files is described here.)

Timeline for d5t8sb3: