SCOPe 2.07: Domain d5t8ta3: 5t8t A:237-389

Lineage for d5t8ta3 (5t8t A:237-389)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:242231] [323456] (2 PDB entries)

8. Domain d5t8ta3: 5t8t A:237-389 [323459]
   automated match to d1mxaa3
   complexed with amp, mg

Details for d5t8ta3

PDB Entry: 5t8t, 2.1 Å

PDB Description: crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium

PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d5t8ta3:

Sequence; same for both SEQRES and ATOM records:

>d5t8ta3 d.130.1.0 (A:237-389) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
iggpqgdcgltgrkiivdtyggaaphgggafsgkdpskvdrsaayacryvaknivaagla
tqcqiqvsyaigvaeptsisidtfgtgkiseeklialvcehfdlrpkgivqmldllrpiy
gksaayghfgreepeftwertdkaaslkaaagl

Timeline for d5t8ta3:

• d5t8ta3 first appeared in SCOPe 2.06
  
• d5t8ta3 appears in the current release, SCOPe 2.08