![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
![]() | Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
![]() | Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
![]() | Protein automated matches [254617] (15 species) not a true protein |
![]() | Species Neisseria gonorrhoeae [TaxId:242231] [323456] (2 PDB entries) |
![]() | Domain d5t8ta2: 5t8t A:114-236 [323458] automated match to d1rg9a2 complexed with amp, mg |
PDB Entry: 5t8t (more details), 2.1 Å
SCOPe Domain Sequences for d5t8ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t8ta2 d.130.1.0 (A:114-236) automated matches {Neisseria gonorrhoeae [TaxId: 242231]} dlnqgagdqglmfgyacdetptlmpfaiyyshrlmqrqselrkdgrlpwlrpdakaqltv vydsetgkvkridtvvlstqhdpaisqeelskavieqiikpvlppelltdetkylinptg rfv
Timeline for d5t8ta2: