SCOPe 2.06: Domain d5jr8b_: 5jr8 B:

Lineage for d5jr8b_ (5jr8 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (39 PDB entries)

8. Domain d5jr8b_: 5jr8 B: [323427]
   automated match to d1ngla_
   complexed with gol, po4; mutant

Details for d5jr8b_

PDB Entry: 5jr8, 2.65 Å

PDB Description: disposal of iron by a mutant form of siderocalin ngal

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d5jr8b_:

Sequence; same for both SEQRES and ATOM records:

>d5jr8b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplssvplqqnfqdnqfqgkwyvvglagnailrededpqkmyatiyelkedksy
nvtsvlfrddgcdywirtfvpgcqpgeftlgniqsypgltsylvrvvstnynqfamvffk
kvsqnqeyfkitlygrtkeltselqenfirfskslglpennivfpvpidqcid

Timeline for d5jr8b_:

• d5jr8b_ is new in SCOPe 2.06-stable
  
• d5jr8b_ appears in SCOPe 2.07
  
• d5jr8b_ appears in the current release, SCOPe 2.08