Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [256383] (9 PDB entries) |
Domain d5iusa1: 5ius A:29-146 [323349] Other proteins in same PDB: d5iusa2, d5iusb2 automated match to d3rrqa_ complexed with cl; mutant |
PDB Entry: 5ius (more details), 2.89 Å
SCOPe Domain Sequences for d5iusa1:
Sequence, based on SEQRES records: (download)
>d5iusa1 b.1.1.1 (A:29-146) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} drpwnpptfspallvvtegdnatftcsfsntsesfhvvwhrespsgqtdtlaafpedrsq pgqdarfrvtqlpngrdfhmsvvrarrndsgtyvcgvislapkiqikeslraelrvte
>d5iusa1 b.1.1.1 (A:29-146) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} drpwnpptfspallvvtegdnatftcsfsntsesfhvvwhrespsgqtdtlaafpedrpg qdarfrvtqlpngrdfhmsvvrarrndsgtyvcgvislapkiqikeslraelrvte
Timeline for d5iusa1: