Lineage for d5dx6a1 (5dx6 A:6-187)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122891Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2122892Protein automated matches [227126] (20 species)
    not a true protein
  7. 2122996Species Klebsiella pneumoniae [TaxId:573] [319715] (2 PDB entries)
  8. 2122997Domain d5dx6a1: 5dx6 A:6-187 [323337]
    Other proteins in same PDB: d5dx6a2, d5dx6b2, d5dx6b4
    automated match to d1ozha2
    complexed with 5gy, 65s, mg, po4, tpp

Details for d5dx6a1

PDB Entry: 5dx6 (more details), 1.75 Å

PDB Description: acetolactate synthase from klebsiella pneumoniae soaked with beta- fluoropyruvate
PDB Compounds: (A:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d5dx6a1:

Sequence, based on SEQRES records: (download)

>d5dx6a1 c.36.1.0 (A:6-187) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaa
avgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdtv
amfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpasg
ap

Sequence, based on observed residues (ATOM records): (download)

>d5dx6a1 c.36.1.0 (A:6-187) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaa
avgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakmdtvamfsp
vtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpap

SCOPe Domain Coordinates for d5dx6a1:

Click to download the PDB-style file with coordinates for d5dx6a1.
(The format of our PDB-style files is described here.)

Timeline for d5dx6a1: