![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (20 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [319715] (2 PDB entries) |
![]() | Domain d5dx6a1: 5dx6 A:6-187 [323337] Other proteins in same PDB: d5dx6a2, d5dx6b2, d5dx6b4 automated match to d1ozha2 complexed with 5gy, 65s, mg, po4, tpp |
PDB Entry: 5dx6 (more details), 1.75 Å
SCOPe Domain Sequences for d5dx6a1:
Sequence, based on SEQRES records: (download)
>d5dx6a1 c.36.1.0 (A:6-187) automated matches {Klebsiella pneumoniae [TaxId: 573]} pvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaa avgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdtv amfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpasg ap
>d5dx6a1 c.36.1.0 (A:6-187) automated matches {Klebsiella pneumoniae [TaxId: 573]} pvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaa avgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakmdtvamfsp vtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpap
Timeline for d5dx6a1:
![]() Domains from other chains: (mouse over for more information) d5dx6b1, d5dx6b2, d5dx6b3, d5dx6b4 |