Lineage for d5f3hd2 (5f3h D:107-211)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364504Domain d5f3hd2: 5f3h D:107-211 [323297]
    Other proteins in same PDB: d5f3hb1, d5f3hd1, d5f3hf1, d5f3hh1, d5f3hi_, d5f3hj_, d5f3hk_, d5f3hl_
    automated match to d1dn0a2

Details for d5f3hd2

PDB Entry: 5f3h (more details), 2.7 Å

PDB Description: structure of myostatin in complex with humanized rk35 antibody
PDB Compounds: (D:) humanized RK35 antibody light chain

SCOPe Domain Sequences for d5f3hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f3hd2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d5f3hd2:

Click to download the PDB-style file with coordinates for d5f3hd2.
(The format of our PDB-style files is described here.)

Timeline for d5f3hd2: