![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries) Uniprot P19483 |
![]() | Domain d1bmfc3: 1bmf C:95-379 [32328] Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfb1, d1bmfb2, d1bmfc1, d1bmfc2, d1bmfd1, d1bmfd2, d1bmfd3, d1bmfe1, d1bmfe2, d1bmfe3, d1bmff1, d1bmff2, d1bmff3, d1bmfg_ complexed with adp, anp, mg |
PDB Entry: 1bmf (more details), 2.85 Å
SCOPe Domain Sequences for d1bmfc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmfc3 c.37.1.11 (C:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq
Timeline for d1bmfc3: